PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr4g109980.1
Common NameMTR_4g109980
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family Dof
Protein Properties Length: 321aa    MW: 34539.6 Da    PI: 6.7308
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr4g109980.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.53.4e-393796362
           zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                     ++ +kcprCds ntkfCyynny+lsqPr+fCk+CrryWtkGG lrnvPvGgg+rk+k+ss
  Medtr4g109980.1 37 QEVMKCPRCDSINTKFCYYNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRKSKRSS 96
                     6789*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-253890IPR003851Zinc finger, Dof-type
PfamPF027011.7E-333894IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.5714094IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104278IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MQEIQHSIGG AGGTRFFGGG GGDRRLRPNQ NNNNLNQEVM KCPRCDSINT KFCYYNNYNL  60
SQPRHFCKNC RRYWTKGGVL RNVPVGGGCR KSKRSSKPKK SSSSDSTVLP TTPPEAPENK  120
SNSHSSSESS SLTAAAVTET VSEPPPEKKI NRGFENDSLE QGTGDCGIFS EIATFTSLIT  180
SSNETLPFGF GIGNDNRNGN VNVNGFNDAS SFQWQNQKLM SVTGDQKHHE EDALKLLPEN  240
IGGGAGGGGS SGSGSLMDHG IDFSLLQSKT SNGGFGSLDW NGDGSADHQG LFDLPNTVDH  300
GYWNHTQWSD QDHSSLFHLP *
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00570DAPTransfer from AT5G60850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754452e-32HG975445.1 Solanum pennellii chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013458026.10.0Dof domain zinc finger protein
TrEMBLA0A072UQU90.0A0A072UQU9_MEDTR; Dof domain zinc finger protein
STRINGGLYMA17G08950.16e-84(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59983050
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.13e-42OBF binding protein 4
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]